Class b: All beta proteins [48724] (176 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins) barrel, closed; n=8, S=12, meander |
Protein Salivary lipocalin [74996] (1 species) |
Species Pig (Sus scrofa) [TaxId:9823] [74997] (1 PDB entry) |
Domain d1gm6a_: 1gm6 A: [70272] complexed with cd, gol, nag |
PDB Entry: 1gm6 (more details), 2.13 Å
SCOPe Domain Sequences for d1gm6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gm6a_ b.60.1.1 (A:) Salivary lipocalin {Pig (Sus scrofa) [TaxId: 9823]} vvtsnfdaskiagewysillasdakenieengsmrvfvehirvldnsslafkfqrkvnge ctdfyavcdkvgdgvytvayygenkfrllevnysdyvilhlvdvngdktfqlmefygrkp dvepklkdkfveicqqygiikeniidltkidrcfqlrgs
Timeline for d1gm6a_: