Lineage for d1gm6a_ (1gm6 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1799770Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1799771Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1799772Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 1800189Protein Salivary lipocalin [74996] (1 species)
  7. 1800190Species Pig (Sus scrofa) [TaxId:9823] [74997] (1 PDB entry)
  8. 1800191Domain d1gm6a_: 1gm6 A: [70272]
    complexed with cd, gol, nag

Details for d1gm6a_

PDB Entry: 1gm6 (more details), 2.13 Å

PDB Description: 3-d structure of a salivary lipocalin from boar
PDB Compounds: (A:) salivary lipocalin

SCOPe Domain Sequences for d1gm6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gm6a_ b.60.1.1 (A:) Salivary lipocalin {Pig (Sus scrofa) [TaxId: 9823]}
vvtsnfdaskiagewysillasdakenieengsmrvfvehirvldnsslafkfqrkvnge
ctdfyavcdkvgdgvytvayygenkfrllevnysdyvilhlvdvngdktfqlmefygrkp
dvepklkdkfveicqqygiikeniidltkidrcfqlrgs

SCOPe Domain Coordinates for d1gm6a_:

Click to download the PDB-style file with coordinates for d1gm6a_.
(The format of our PDB-style files is described here.)

Timeline for d1gm6a_: