Lineage for d1gl7a_ (1gl7 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2112131Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 protein domains)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2112146Protein Bacterial conjugative coupling protein TrwB [69492] (1 species)
  7. 2112147Species Escherichia coli [TaxId:562] [69493] (5 PDB entries)
  8. 2112178Domain d1gl7a_: 1gl7 A: [70265]
    complexed with anp, cl

Details for d1gl7a_

PDB Entry: 1gl7 (more details), 3 Å

PDB Description: plasmid coupling protein trwb in complex with the non-hydrolisable atp-analogue adpnp.
PDB Compounds: (A:) conjugal transfer protein trwb

SCOPe Domain Sequences for d1gl7a_:

Sequence, based on SEQRES records: (download)

>d1gl7a_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]}
efggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngatgtgks
vllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneirndydw
qryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfddlrgf
legtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggnlfitw
redmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladaltkgrka
glrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslgehever
dryskntgkhhstgralervrervvmpaeianlpdltayvgfagnrpiakvpleikqfan
rqpafve

Sequence, based on observed residues (ATOM records): (download)

>d1gl7a_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]}
efggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngatgtgks
vllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneirndydw
qryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfddlrgf
legtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggnlfitw
redmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladaltkgrka
glrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslgehever
dervrervvmpaeianlpdltayvgfagnrpiakvpleikqfanrqpafve

SCOPe Domain Coordinates for d1gl7a_:

Click to download the PDB-style file with coordinates for d1gl7a_.
(The format of our PDB-style files is described here.)

Timeline for d1gl7a_: