![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) ![]() the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
![]() | Family c.1.9.6: Hydantoinase (dihydropyrimidinase), catalytic domain [75073] (5 proteins) automatically mapped to Pfam PF13147 |
![]() | Protein L-hydantoinase [75077] (1 species) |
![]() | Species Arthrobacter aurescens [TaxId:43663] [75078] (1 PDB entry) |
![]() | Domain d1gkrb2: 1gkr B:55-379 [70254] Other proteins in same PDB: d1gkra1, d1gkrb1, d1gkrc1, d1gkrd1 complexed with zn |
PDB Entry: 1gkr (more details), 2.6 Å
SCOPe Domain Sequences for d1gkrb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gkrb2 c.1.9.6 (B:55-379) L-hydantoinase {Arthrobacter aurescens [TaxId: 43663]} gvvdehvhiidmdlknrygrfeldsesaavggittiiempitfpptttldaflekkkqag qrlkvdfalygggvpgnlpeirkmhdagavgfksmmaasvpgmfdavsdgelfeifqeia acgsvivvhaenetiiqalqkqikaaggkdmaayeasqpvfqeneaiqralllqkeagcr livlhvsnpdgvelihqaqsegqdvhcesgpqylnittddaerigpymkvappvrsaemn irlweqlenglidtlgsdhgghpvedkepgwkdvwkagngalgletslpmmltngvnkgr lslerlvevmcekpaklfgiypqkg
Timeline for d1gkrb2: