Lineage for d1gkrb2 (1gkr B:55-379)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2419618Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2419899Family c.1.9.6: Hydantoinase (dihydropyrimidinase), catalytic domain [75073] (5 proteins)
    automatically mapped to Pfam PF13147
  6. 2419949Protein L-hydantoinase [75077] (1 species)
  7. 2419950Species Arthrobacter aurescens [TaxId:43663] [75078] (1 PDB entry)
  8. 2419952Domain d1gkrb2: 1gkr B:55-379 [70254]
    Other proteins in same PDB: d1gkra1, d1gkrb1, d1gkrc1, d1gkrd1
    complexed with zn

Details for d1gkrb2

PDB Entry: 1gkr (more details), 2.6 Å

PDB Description: l-hydantoinase (dihydropyrimidinase) from arthrobacter aurescens
PDB Compounds: (B:) non-ATP dependent l-selective hydantoinase

SCOPe Domain Sequences for d1gkrb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gkrb2 c.1.9.6 (B:55-379) L-hydantoinase {Arthrobacter aurescens [TaxId: 43663]}
gvvdehvhiidmdlknrygrfeldsesaavggittiiempitfpptttldaflekkkqag
qrlkvdfalygggvpgnlpeirkmhdagavgfksmmaasvpgmfdavsdgelfeifqeia
acgsvivvhaenetiiqalqkqikaaggkdmaayeasqpvfqeneaiqralllqkeagcr
livlhvsnpdgvelihqaqsegqdvhcesgpqylnittddaerigpymkvappvrsaemn
irlweqlenglidtlgsdhgghpvedkepgwkdvwkagngalgletslpmmltngvnkgr
lslerlvevmcekpaklfgiypqkg

SCOPe Domain Coordinates for d1gkrb2:

Click to download the PDB-style file with coordinates for d1gkrb2.
(The format of our PDB-style files is described here.)

Timeline for d1gkrb2: