Class b: All beta proteins [48724] (174 folds) |
Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily) pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns |
Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (11 families) this domain is interrupted by the catalytic beta/alpha barrel domain |
Family b.92.1.3: Hydantoinase (dihydropyrimidinase) [75044] (5 proteins) |
Protein L-hydantoinase [75048] (1 species) |
Species Arthrobacter aurescens [TaxId:43663] [75049] (1 PDB entry) |
Domain d1gkrb1: 1gkr B:1-54,B:380-451 [70253] Other proteins in same PDB: d1gkra2, d1gkrb2, d1gkrc2, d1gkrd2 complexed with zn |
PDB Entry: 1gkr (more details), 2.6 Å
SCOPe Domain Sequences for d1gkrb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gkrb1 b.92.1.3 (B:1-54,B:380-451) L-hydantoinase {Arthrobacter aurescens [TaxId: 43663]} mfdvivkncrlvssdgiteadilvkdgkvaaisadtsdveasrtidaggkfvmpXtlqvg sdadllildldidtkvdasqfrslhkyspfdgmpvtgapvltmvrgtvvaekgevlveqg fgqfvtr
Timeline for d1gkrb1: