Lineage for d1gkrb1 (1gkr B:1-54,B:380-451)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 965039Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 965040Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (11 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 965092Family b.92.1.3: Hydantoinase (dihydropyrimidinase) [75044] (5 proteins)
  6. 965142Protein L-hydantoinase [75048] (1 species)
  7. 965143Species Arthrobacter aurescens [TaxId:43663] [75049] (1 PDB entry)
  8. 965145Domain d1gkrb1: 1gkr B:1-54,B:380-451 [70253]
    Other proteins in same PDB: d1gkra2, d1gkrb2, d1gkrc2, d1gkrd2
    complexed with zn

Details for d1gkrb1

PDB Entry: 1gkr (more details), 2.6 Å

PDB Description: l-hydantoinase (dihydropyrimidinase) from arthrobacter aurescens
PDB Compounds: (B:) non-ATP dependent l-selective hydantoinase

SCOPe Domain Sequences for d1gkrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gkrb1 b.92.1.3 (B:1-54,B:380-451) L-hydantoinase {Arthrobacter aurescens [TaxId: 43663]}
mfdvivkncrlvssdgiteadilvkdgkvaaisadtsdveasrtidaggkfvmpXtlqvg
sdadllildldidtkvdasqfrslhkyspfdgmpvtgapvltmvrgtvvaekgevlveqg
fgqfvtr

SCOPe Domain Coordinates for d1gkrb1:

Click to download the PDB-style file with coordinates for d1gkrb1.
(The format of our PDB-style files is described here.)

Timeline for d1gkrb1: