Lineage for d1gkra2 (1gkr A:55-379)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 971605Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 971817Family c.1.9.6: Hydantoinase (dihydropyrimidinase), catalytic domain [75073] (5 proteins)
  6. 971867Protein L-hydantoinase [75077] (1 species)
  7. 971868Species Arthrobacter aurescens [TaxId:43663] [75078] (1 PDB entry)
  8. 971869Domain d1gkra2: 1gkr A:55-379 [70252]
    Other proteins in same PDB: d1gkra1, d1gkrb1, d1gkrc1, d1gkrd1
    complexed with zn

Details for d1gkra2

PDB Entry: 1gkr (more details), 2.6 Å

PDB Description: l-hydantoinase (dihydropyrimidinase) from arthrobacter aurescens
PDB Compounds: (A:) non-ATP dependent l-selective hydantoinase

SCOPe Domain Sequences for d1gkra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gkra2 c.1.9.6 (A:55-379) L-hydantoinase {Arthrobacter aurescens [TaxId: 43663]}
gvvdehvhiidmdlknrygrfeldsesaavggittiiempitfpptttldaflekkkqag
qrlkvdfalygggvpgnlpeirkmhdagavgfksmmaasvpgmfdavsdgelfeifqeia
acgsvivvhaenetiiqalqkqikaaggkdmaayeasqpvfqeneaiqralllqkeagcr
livlhvsnpdgvelihqaqsegqdvhcesgpqylnittddaerigpymkvappvrsaemn
irlweqlenglidtlgsdhgghpvedkepgwkdvwkagngalgletslpmmltngvnkgr
lslerlvevmcekpaklfgiypqkg

SCOPe Domain Coordinates for d1gkra2:

Click to download the PDB-style file with coordinates for d1gkra2.
(The format of our PDB-style files is described here.)

Timeline for d1gkra2: