![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily) pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns |
![]() | Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) ![]() this domain is interrupted by the catalytic beta/alpha barrel domain |
![]() | Family b.92.1.3: Hydantoinase (dihydropyrimidinase) [75044] (5 proteins) |
![]() | Protein L-hydantoinase [75048] (1 species) |
![]() | Species Arthrobacter aurescens [TaxId:43663] [75049] (1 PDB entry) |
![]() | Domain d1gkra1: 1gkr A:1-54,A:380-451 [70251] Other proteins in same PDB: d1gkra2, d1gkrb2, d1gkrc2, d1gkrd2 complexed with zn |
PDB Entry: 1gkr (more details), 2.6 Å
SCOPe Domain Sequences for d1gkra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gkra1 b.92.1.3 (A:1-54,A:380-451) L-hydantoinase {Arthrobacter aurescens [TaxId: 43663]} mfdvivkncrlvssdgiteadilvkdgkvaaisadtsdveasrtidaggkfvmpXtlqvg sdadllildldidtkvdasqfrslhkyspfdgmpvtgapvltmvrgtvvaekgevlveqg fgqfvtr
Timeline for d1gkra1: