SCOP 1.75: Domain d1gkqc1: 1gkq C:2-54,C:390-459

Lineage for d1gkqc1 (1gkq C:2-54,C:390-459)

Root: SCOP 1.75
Class b: All beta proteins [48724] (174 folds)
Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (11 families)
this domain is interrupted by the catalytic beta/alpha barrel domain
Family b.92.1.3: Hydantoinase (dihydropyrimidinase) [75044] (5 proteins)
Protein D-hydantoinase [75045] (4 species)
Species Thermus sp. [TaxId:275] [75046] (2 PDB entries)
Domain d1gkqc1: 1gkq C:2-54,C:390-459 [70247]
Other proteins in same PDB: d1gkqa2, d1gkqb2, d1gkqc2, d1gkqd2

Details for d1gkqc1

PDB Entry: 1gkq (more details), 2.6 Å

PDB Description: d-hydantoinase (dihydropyrimidinase) from thermus sp. in space group p212121

PDB Compounds: (C:) hydantoinase

SCOP Domain Sequences for d1gkqc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gkqc1 b.92.1.3 (C:2-54,C:390-459) D-hydantoinase {Thermus sp. [TaxId: 275]}
pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvfpgXadlvvy
dpqyrgtisvktqhvnndyngfegfeidgrpsvvtvrgkvavrdgqfvgekgwgkllrre
pmyf

SCOP Domain Coordinates for d1gkqc1:

Click to download the PDB-style file with coordinates for d1gkqc1.
(The format of our PDB-style files is described here.)

Timeline for d1gkqc1: