SCOPe 2.05: Domain d1gkqb1: 1gkq B:2-54,B:390-459

Lineage for d1gkqb1 (1gkq B:2-54,B:390-459)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
   pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns

4. Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families)
   this domain is interrupted by the catalytic beta/alpha barrel domain

5. Family b.92.1.3: Hydantoinase (dihydropyrimidinase) [75044] (5 proteins)

6. Protein D-hydantoinase [75045] (4 species)

7. Species Thermus sp. [TaxId:275] [75046] (2 PDB entries)

8. Domain d1gkqb1: 1gkq B:2-54,B:390-459 [70245]
   Other proteins in same PDB: d1gkqa2, d1gkqb2, d1gkqc2, d1gkqd2
   complexed with zn

Details for d1gkqb1

PDB Entry: 1gkq, 2.6 Å

PDB Description: d-hydantoinase (dihydropyrimidinase) from thermus sp. in space group p212121

PDB Compounds: (B:) hydantoinase

SCOPe Domain Sequences for d1gkqb1:

Sequence; same for both SEQRES and ATOM records:

>d1gkqb1 b.92.1.3 (B:2-54,B:390-459) D-hydantoinase {Thermus sp. [TaxId: 275]}
pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvfpgXadlvvy
dpqyrgtisvktqhvnndyngfegfeidgrpsvvtvrgkvavrdgqfvgekgwgkllrre
pmyf

Timeline for d1gkqb1:

• d1gkqb1 first appeared in SCOP 1.61
  
• d1gkqb1 appears in SCOPe 2.04
  
• d1gkqb1 appears in SCOPe 2.06
  
• d1gkqb1 appears in the current release, SCOPe 2.08