Lineage for d1gkqb1 (1gkq B:2-54,B:390-459)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 568555Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 568556Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (7 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 568608Family b.92.1.3: Hydantoinase (dihydropyrimidinase) [75044] (3 proteins)
  6. 568609Protein D-hydantoinase [75045] (3 species)
  7. 568624Species Thermus sp. [TaxId:275] [75046] (2 PDB entries)
  8. 568632Domain d1gkqb1: 1gkq B:2-54,B:390-459 [70245]
    Other proteins in same PDB: d1gkqa2, d1gkqb2, d1gkqc2, d1gkqd2

Details for d1gkqb1

PDB Entry: 1gkq (more details), 2.6 Å

PDB Description: d-hydantoinase (dihydropyrimidinase) from thermus sp. in space group p212121

SCOP Domain Sequences for d1gkqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gkqb1 b.92.1.3 (B:2-54,B:390-459) D-hydantoinase {Thermus sp.}
pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvfpgXadlvvy
dpqyrgtisvktqhvnndyngfegfeidgrpsvvtvrgkvavrdgqfvgekgwgkllrre
pmyf

SCOP Domain Coordinates for d1gkqb1:

Click to download the PDB-style file with coordinates for d1gkqb1.
(The format of our PDB-style files is described here.)

Timeline for d1gkqb1: