Lineage for d1gkpf1 (1gkp F:2-54,F:390-459)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1333200Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 1333201Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (11 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 1333259Family b.92.1.3: Hydantoinase (dihydropyrimidinase) [75044] (5 proteins)
  6. 1333260Protein D-hydantoinase [75045] (4 species)
  7. 1333278Species Thermus sp. [TaxId:275] [75046] (2 PDB entries)
  8. 1333284Domain d1gkpf1: 1gkp F:2-54,F:390-459 [70241]
    Other proteins in same PDB: d1gkpa2, d1gkpb2, d1gkpc2, d1gkpd2, d1gkpe2, d1gkpf2
    complexed with epe, so4, zn

Details for d1gkpf1

PDB Entry: 1gkp (more details), 1.29 Å

PDB Description: d-hydantoinase (dihydropyrimidinase) from thermus sp. in space group c2221
PDB Compounds: (F:) hydantoinase

SCOPe Domain Sequences for d1gkpf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gkpf1 b.92.1.3 (F:2-54,F:390-459) D-hydantoinase {Thermus sp. [TaxId: 275]}
pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvfpgXadlvvy
dpqyrgtisvktqhvnndyngfegfeidgrpsvvtvrgkvavrdgqfvgekgwgkllrre
pmyf

SCOPe Domain Coordinates for d1gkpf1:

Click to download the PDB-style file with coordinates for d1gkpf1.
(The format of our PDB-style files is described here.)

Timeline for d1gkpf1: