Lineage for d1gkpe2 (1gkp E:55-389)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 475145Superfamily c.1.9: Metallo-dependent hydrolases [51556] (13 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 475254Family c.1.9.6: Hydantoinase (dihydropyrimidinase), catalytic domain [75073] (3 proteins)
  6. 475255Protein D-hydantoinase [75074] (3 species)
  7. 475270Species Thermus sp. [TaxId:275] [75075] (2 PDB entries)
  8. 475275Domain d1gkpe2: 1gkp E:55-389 [70240]
    Other proteins in same PDB: d1gkpa1, d1gkpb1, d1gkpc1, d1gkpd1, d1gkpe1, d1gkpf1

Details for d1gkpe2

PDB Entry: 1gkp (more details), 1.29 Å

PDB Description: d-hydantoinase (dihydropyrimidinase) from thermus sp. in space group c2221

SCOP Domain Sequences for d1gkpe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gkpe2 c.1.9.6 (E:55-389) D-hydantoinase {Thermus sp.}
fidphvhiylpfmatfakdthetgskaalmggtttyiemccpsrnddalegyqlwkskae
gnsycdytfhmavskfdektegqlreivadgissfkiflsyknffgvddgemyqtlrlak
elgvivtahcenaelvgrlqqkllsegktgpewhepsrpeaveaegtarfatflettgat
gyvvhlsckpaldaamaakargvpiyiesviphflldktyaerggveamkyimspplrdk
rnqkvlwdalaqgfidtvgtdhcpfdteqkllgkeaftaipngipaiedrvnllytygvs
rgrldihrfvdaastkaaklfglfprkgtiavgsd

SCOP Domain Coordinates for d1gkpe2:

Click to download the PDB-style file with coordinates for d1gkpe2.
(The format of our PDB-style files is described here.)

Timeline for d1gkpe2: