SCOP 1.75: Domain d1gkpe1: 1gkp E:2-54,E:390-459

Lineage for d1gkpe1 (1gkp E:2-54,E:390-459)

Root: SCOP 1.75
Class b: All beta proteins [48724] (174 folds)
Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (11 families)
this domain is interrupted by the catalytic beta/alpha barrel domain
Family b.92.1.3: Hydantoinase (dihydropyrimidinase) [75044] (5 proteins)
Protein D-hydantoinase [75045] (4 species)
Species Thermus sp. [TaxId:275] [75046] (2 PDB entries)
Domain d1gkpe1: 1gkp E:2-54,E:390-459 [70239]
Other proteins in same PDB: d1gkpa2, d1gkpb2, d1gkpc2, d1gkpd2, d1gkpe2, d1gkpf2

Details for d1gkpe1

PDB Entry: 1gkp (more details), 1.29 Å

PDB Description: d-hydantoinase (dihydropyrimidinase) from thermus sp. in space group c2221

PDB Compounds: (E:) hydantoinase

SCOP Domain Sequences for d1gkpe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gkpe1 b.92.1.3 (E:2-54,E:390-459) D-hydantoinase {Thermus sp. [TaxId: 275]}
pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvfpgXadlvvy
dpqyrgtisvktqhvnndyngfegfeidgrpsvvtvrgkvavrdgqfvgekgwgkllrre
pmyf

SCOP Domain Coordinates for d1gkpe1:

Click to download the PDB-style file with coordinates for d1gkpe1.
(The format of our PDB-style files is described here.)

Timeline for d1gkpe1: