Lineage for d1gkpb2 (1gkp B:55-389)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 173878Superfamily c.1.9: Metallo-dependent hydrolases [51556] (8 families) (S)
  5. 173966Family c.1.9.6: Hydantoinase (dihydropyrimidinase), catalytic domain [75073] (2 proteins)
  6. 173967Protein D-hydantoinase [75074] (2 species)
  7. 173977Species Thermus sp. [TaxId:275] [75075] (2 PDB entries)
  8. 173979Domain d1gkpb2: 1gkp B:55-389 [70234]
    Other proteins in same PDB: d1gkpa1, d1gkpb1, d1gkpc1, d1gkpd1, d1gkpe1, d1gkpf1

Details for d1gkpb2

PDB Entry: 1gkp (more details), 1.29 Å

PDB Description: d-hydantoinase (dihydropyrimidinase) from thermus sp. in space group c2221

SCOP Domain Sequences for d1gkpb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gkpb2 c.1.9.6 (B:55-389) D-hydantoinase {Thermus sp.}
fidphvhiylpfmatfakdthetgskaalmggtttyiemccpsrnddalegyqlwkskae
gnsycdytfhmavskfdektegqlreivadgissfkiflsyknffgvddgemyqtlrlak
elgvivtahcenaelvgrlqqkllsegktgpewhepsrpeaveaegtarfatflettgat
gyvvhlsckpaldaamaakargvpiyiesviphflldktyaerggveamkyimspplrdk
rnqkvlwdalaqgfidtvgtdhcpfdteqkllgkeaftaipngipaiedrvnllytygvs
rgrldihrfvdaastkaaklfglfprkgtiavgsd

SCOP Domain Coordinates for d1gkpb2:

Click to download the PDB-style file with coordinates for d1gkpb2.
(The format of our PDB-style files is described here.)

Timeline for d1gkpb2: