Lineage for d1gkna2 (1gkn A:961-1024)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2260769Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 2260770Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) (S)
  5. 2260771Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
    Pfam PF00084
  6. 2260960Protein Complement receptor 1, cr1 [75680] (1 species)
  7. 2260961Species Human (Homo sapiens) [TaxId:9606] [75681] (3 PDB entries)
  8. 2260964Domain d1gkna2: 1gkn A:961-1024 [70230]
    modules 15 and 16

Details for d1gkna2

PDB Entry: 1gkn (more details)

PDB Description: structure determination and rational mutagenesis reveal binding surface of immune adherence receptor, cr1 (cd35)
PDB Compounds: (A:) complement receptor type 1

SCOPe Domain Sequences for d1gkna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gkna2 g.18.1.1 (A:961-1024) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]}
kscktppdpvngmvhvitdiqvgsrityscttghrlighssaecilsgntahwstkppic
qrip

SCOPe Domain Coordinates for d1gkna2:

Click to download the PDB-style file with coordinates for d1gkna2.
(The format of our PDB-style files is described here.)

Timeline for d1gkna2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gkna1