Lineage for d1gkna1 (1gkn A:897-960)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2585277Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 2585278Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) (S)
  5. 2585279Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
    Pfam PF00084
  6. 2585468Protein Complement receptor 1, cr1 [75680] (1 species)
  7. 2585469Species Human (Homo sapiens) [TaxId:9606] [75681] (3 PDB entries)
  8. 2585471Domain d1gkna1: 1gkn A:897-960 [70229]
    modules 15 and 16

Details for d1gkna1

PDB Entry: 1gkn (more details)

PDB Description: structure determination and rational mutagenesis reveal binding surface of immune adherence receptor, cr1 (cd35)
PDB Compounds: (A:) complement receptor type 1

SCOPe Domain Sequences for d1gkna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gkna1 g.18.1.1 (A:897-960) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]}
eaeahcqapdhflfaklktqttasdfpigtslkyecrpeyygrpfsitcldnlvwsspkd
vckr

SCOPe Domain Coordinates for d1gkna1:

Click to download the PDB-style file with coordinates for d1gkna1.
(The format of our PDB-style files is described here.)

Timeline for d1gkna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gkna2