Lineage for d1gkma_ (1gkm A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2337216Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2337217Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2337357Family a.127.1.2: HAL/PAL-like [48572] (3 protein domains)
    Pfam PF00221
  6. 2337358Protein Histidine ammonia-lyase (HAL) [48573] (1 species)
  7. 2337359Species Pseudomonas putida [TaxId:303] [48574] (6 PDB entries)
  8. 2337360Domain d1gkma_: 1gkm A: [70228]
    complexed with cys, gol, o, so4

Details for d1gkma_

PDB Entry: 1gkm (more details), 1 Å

PDB Description: histidine ammonia-lyase (hal) from pseudomonas putida inhibited with l-cysteine
PDB Compounds: (A:) histidine ammonia-lyase

SCOPe Domain Sequences for d1gkma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gkma_ a.127.1.2 (A:) Histidine ammonia-lyase (HAL) {Pseudomonas putida [TaxId: 303]}
teltlkpgtltlaqlraihaapvrlqldasaapaidasvacveqiiaedrtaygintgfg
llastriashdlenlqrslvlshaagigapldddlvrlimvlkinslsrgfsgirrkvid
alialvnaevyphiplkgsvgasgdlaplahmslvllgegkarykgqwlsatealavagl
epltlaakeglallngtqastayalrglfyaedlyaaaiacgglsveavlgsrspfdari
heargqrgqidtaacfrdllgdssevslshknadkvqdpyslrcqpqvmgacltqlrqaa
evlgieanavsdnplvfaaegdvisggnfhaepvamaadnlalaiaeigslserrislmm
dkhmsqlppflvenggvnsgfmiaqvtaaalasenkalshphsvdslptsanqedhvsma
paagkrlwemaentrgvlaiewlgacqgldlrkglktsaklekarqalrsevahydrdrf
fapdiekavellakgsltgllpagvlpsl

SCOPe Domain Coordinates for d1gkma_:

Click to download the PDB-style file with coordinates for d1gkma_.
(The format of our PDB-style files is described here.)

Timeline for d1gkma_: