Lineage for d1gkga1 (1gkg A:957-1022)

  1. Root: SCOP 1.61
  2. 202290Class g: Small proteins [56992] (59 folds)
  3. 204192Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
  4. 204193Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family) (S)
  5. 204194Family g.18.1.1: Complement control module/SCR domain [57536] (8 proteins)
  6. 204262Protein Complement receptor 1, cr1 [75680] (1 species)
  7. 204263Species Human (Homo sapiens) [TaxId:9606] [75681] (2 PDB entries)
  8. 204266Domain d1gkga1: 1gkg A:957-1022 [70219]

Details for d1gkga1

PDB Entry: 1gkg (more details)

PDB Description: structure determination and rational mutagenesis reveal binding surface of immune adherence receptor, cr1 (cd35)
PDB Compounds: (A:)

SCOP Domain Sequences for d1gkga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gkga1 g.18.1.1 (A:957-1022) Complement receptor 1, cr1 {Human (Homo sapiens)}
eaeakscktppdpvngmvhvitdiqvgsrityscttghrlighssaecilsgntahwstk
ppicqr

SCOP Domain Coordinates for d1gkga1:

Click to download the PDB-style file with coordinates for d1gkga1.
(The format of our PDB-style files is described here.)

Timeline for d1gkga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gkga2