SCOPe 2.06: Domain d1gkdb_: 1gkd B:

Lineage for d1gkdb_ (1gkd B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein Gelatinase B (MMP-9) [75496] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75497] (16 PDB entries)

8. Domain d1gkdb_: 1gkd B: [70218]
   complexed with bum, ca, stn, zn; mutant

Details for d1gkdb_

PDB Entry: 1gkd, 2.1 Å

PDB Description: mmp9 active site mutant-inhibitor complex

PDB Compounds: (B:) 92 kda type IV collagenase

SCOPe Domain Sequences for d1gkdb_:

Sequence; same for both SEQRES and ATOM records:

>d1gkdb_ d.92.1.11 (B:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]}
lkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdadiviqfgva
ehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgqgyslflvaahqfghalg
ldhssvpealmypmyrftegpplhkddvngirhly

Timeline for d1gkdb_:

• d1gkdb_ first appeared in SCOP 1.61
  
• d1gkdb_ appears in SCOPe 2.05
  
• d1gkdb_ appears in SCOPe 2.07
  
• d1gkdb_ appears in the current release, SCOPe 2.08