Lineage for d1gkdb_ (1gkd B:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies)
contains mixed beta sheet with connection over free side of the sheetSuperfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) 
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) 
Protein Gelatinase B (MMP-9) [75496] (1 species) Species Human (Homo sapiens) [TaxId:9606] [75497] (18 PDB entries) 
Domain d1gkdb_: 1gkd B: [70218]
complexed with bum, ca, stn, zn; mutant
Details for d1gkdb_
PDB Entry: 1gkd (more details), 2.1 Å
PDB Description: mmp9 active site mutant-inhibitor complex
PDB Compounds: (B:) 92 kda type IV collagenaseSCOPe Domain Sequences for d1gkdb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gkdb_ d.92.1.11 (B:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]}
lkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdadiviqfgva
ehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgqgyslflvaahqfghalg
ldhssvpealmypmyrftegpplhkddvngirhly
SCOPe Domain Coordinates for d1gkdb_:
Click to download the PDB-style file with coordinates for d1gkdb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gkdb_:
- d1gkdb_ first appeared in SCOP 1.61
- d1gkdb_ appears in SCOPe 2.07
View in 3D
