Lineage for d1gkda_ (1gkd A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204982Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2204983Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2205557Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2205700Protein Gelatinase B (MMP-9) [75496] (1 species)
  7. 2205701Species Human (Homo sapiens) [TaxId:9606] [75497] (16 PDB entries)
  8. 2205714Domain d1gkda_: 1gkd A: [70217]
    complexed with bum, ca, stn, zn; mutant

Details for d1gkda_

PDB Entry: 1gkd (more details), 2.1 Å

PDB Description: mmp9 active site mutant-inhibitor complex
PDB Compounds: (A:) 92 kda type IV collagenase

SCOPe Domain Sequences for d1gkda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gkda_ d.92.1.11 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]}
fegdlkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdadiviq
fgvaehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgqgyslflvaahqfg
halgldhssvpealmypmyrftegpplhkddvngirhly

SCOPe Domain Coordinates for d1gkda_:

Click to download the PDB-style file with coordinates for d1gkda_.
(The format of our PDB-style files is described here.)

Timeline for d1gkda_: