Lineage for d1gkca_ (1gkc A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 729090Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 729091Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) (S)
  5. 729341Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins)
  6. 729404Protein Gelatinase B (MMP-9) [75496] (1 species)
  7. 729405Species Human (Homo sapiens) [TaxId:9606] [75497] (8 PDB entries)
  8. 729416Domain d1gkca_: 1gkc A: [70215]

Details for d1gkca_

PDB Entry: 1gkc (more details), 2.3 Å

PDB Description: mmp9-inhibitor complex
PDB Compounds: (A:) 92 kda type IV collagenase

SCOP Domain Sequences for d1gkca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gkca_ d.92.1.11 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]}
fegdlkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdadiviq
fgvaehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgqgyslflvaahefg
halgldhssvpealmypmyrftegpplhkddvngirhly

SCOP Domain Coordinates for d1gkca_:

Click to download the PDB-style file with coordinates for d1gkca_.
(The format of our PDB-style files is described here.)

Timeline for d1gkca_: