SCOPe 2.08: Domain d1gk6a_: 1gk6 A:

Lineage for d1gk6a_ (1gk6 A:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.20: Intermediate filament protein, coiled coil region [64593] (2 families)

5. Family h.1.20.1: Intermediate filament protein, coiled coil region [64594] (3 proteins)
   C-terminal part of Pfam PF00038

6. Protein Vimentin coil [64595] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64596] (3 PDB entries)

8. Domain d1gk6a_: 1gk6 A: [70210]
   coil 2B fragment linked to GCN4 leucine zipper

Details for d1gk6a_

PDB Entry: 1gk6, 1.9 Å

PDB Description: human vimentin coil 2b fragment linked to gcn4 leucine zipper (z2b)

PDB Compounds: (A:) vimentin

SCOPe Domain Sequences for d1gk6a_:

Sequence; same for both SEQRES and ATOM records:

>d1gk6a_ h.1.20.1 (A:) Vimentin coil {Human (Homo sapiens) [TaxId: 9606]}
mkqledkveellsknyhlenevarlkklvgdllnvkmaldieiatyrkllegees

Timeline for d1gk6a_:

• d1gk6a_ first appeared in SCOP 1.61
  
• d1gk6a_ appears in SCOPe 2.07