Lineage for d1gk4a_ (1gk4 A:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3040442Superfamily h.1.20: Intermediate filament protein, coiled coil region [64593] (2 families) (S)
  5. 3040443Family h.1.20.1: Intermediate filament protein, coiled coil region [64594] (3 proteins)
    C-terminal part of Pfam PF00038
  6. 3040447Protein Vimentin coil [64595] (1 species)
  7. 3040448Species Human (Homo sapiens) [TaxId:9606] [64596] (3 PDB entries)
  8. 3040452Domain d1gk4a_: 1gk4 A: [70203]
    coil 2B fragment
    complexed with act

Details for d1gk4a_

PDB Entry: 1gk4 (more details), 2.3 Å

PDB Description: human vimentin coil 2b fragment (cys2)
PDB Compounds: (A:) vimentin

SCOPe Domain Sequences for d1gk4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gk4a_ h.1.20.1 (A:) Vimentin coil {Human (Homo sapiens) [TaxId: 9606]}
cevdalkgtneslerqmremeenfaveaanyqdtigrlqdeiqnmkeemarhlreyqdll
nvkmaldieiatyrklleg

SCOPe Domain Coordinates for d1gk4a_:

Click to download the PDB-style file with coordinates for d1gk4a_.
(The format of our PDB-style files is described here.)

Timeline for d1gk4a_: