SCOP 1.67: Domain d1gjra2: 1gjr A:142-303

Lineage for d1gjra2 (1gjr A:142-303)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families)
   binds NADP differently than classical Rossmann-fold
   N-terminal FAD-linked domain contains (6,10) barrel

5. Family c.25.1.1: Reductases [52344] (4 proteins)

6. Protein Ferredoxin reductase (flavodoxin reductase) [52345] (8 species)

7. Species Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId:1167] [52350] (19 PDB entries)

8. Domain d1gjra2: 1gjr A:142-303 [70198]
   Other proteins in same PDB: d1gjra1
   complexed with fad, nap

Details for d1gjra2

PDB Entry: 1gjr, 2.1 Å

PDB Description: ferredoxin-nadp+ reductase complexed with nadp+ by cocrystallization

SCOP Domain Sequences for d1gjra2:

Sequence; same for both SEQRES and ATOM records:

>d1gjra2 c.25.1.1 (A:142-303) Ferredoxin reductase (flavodoxin reductase) {Cyanobacterium (Anabaena sp.), pcc 7119}
lpddpeanvimlatgtgiapmrtylwrmfkdaeraanpeyqfkgfswlvfgvpttpnily
keeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadqlwqliknqkthtyic
glrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvety

Timeline for d1gjra2:

• d1gjra2 first appeared in SCOP 1.61
  
• d1gjra2 appears in SCOP 1.65
  
• d1gjra2 appears in SCOP 1.69
  
• d1gjra2 appears in the current release, SCOPe 2.08