Lineage for d1gjqb2 (1gjq B:118-543)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 469290Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 469318Superfamily b.70.2: C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51004] (1 family) (S)
  5. 469319Family b.70.2.1: C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51005] (1 protein)
  6. 469320Protein C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51006] (3 species)
    the N-terminal domain is cytochrome c-like
  7. 469349Species Pseudomonas aeruginosa [TaxId:287] [51008] (9 PDB entries)
  8. 469353Domain d1gjqb2: 1gjq B:118-543 [70196]
    Other proteins in same PDB: d1gjqa1, d1gjqb1

Details for d1gjqb2

PDB Entry: 1gjq (more details), 2.7 Å

PDB Description: pseudomonas aeruginosa cd1 nitrite reductase reduced cyanide complex

SCOP Domain Sequences for d1gjqb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gjqb2 b.70.2.1 (B:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa}
ewgmpemreswkvlvkpedrpkkqlndldlpnlfsvtlrdagqialvdgdskkivkvidt
gyavhisrmsasgryllvigrdaridmidlwakeptkvaeikigiearsvesskfkgyed
rytiagaywppqfaimdgetlepkqivstrgmtvdtqtyhpeprvaaiiashehpefivn
vketgkvllvnykdidnltvtsigaapflhdggwdsshryfmtaannsnkvavidskdrr
lsalvdvgktphpgrganfvhpkygpvwstshlgdgsisligtdpknhpqyawkkvaelq
gqgggslfikthpksshlyvdttfnpdarisqsvavfdlknldakyqvlpiaewadlgeg
akrvvqpeynkrgdevwfsvwngkndssalvvvddktlklkavvkdprlitptgkfnvyn
tqhdvy

SCOP Domain Coordinates for d1gjqb2:

Click to download the PDB-style file with coordinates for d1gjqb2.
(The format of our PDB-style files is described here.)

Timeline for d1gjqb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gjqb1