Lineage for d1gjna_ (1gjn A:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 208554Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 208555Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 208567Family a.1.1.2: Globins [46463] (18 proteins)
    Heme-binding protein
  6. 209235Protein Myoglobin [46469] (9 species)
  7. 209240Species Horse (Equus caballus) [TaxId:9796] [46474] (14 PDB entries)
  8. 209243Domain d1gjna_: 1gjn A: [70191]
    complexed with hem, hyd, so4

Details for d1gjna_

PDB Entry: 1gjn (more details), 1.35 Å

PDB Description: hydrogen peroxide derived myoglobin compound ii at ph 5.2

SCOP Domain Sequences for d1gjna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gjna_ a.1.1.2 (A:) Myoglobin {Horse (Equus caballus)}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfqg

SCOP Domain Coordinates for d1gjna_:

Click to download the PDB-style file with coordinates for d1gjna_.
(The format of our PDB-style files is described here.)

Timeline for d1gjna_: