Lineage for d1gjna_ (1gjn A:)
- Root: SCOP 1.61
Class a: All alpha proteins [46456] (151 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies) Superfamily a.1.1: Globin-like [46458] (4 families) 
Family a.1.1.2: Globins [46463] (18 proteins) Protein Myoglobin [46469] (9 species) 
Species Horse (Equus caballus) [TaxId:9796] [46474] (14 PDB entries) 
Domain d1gjna_: 1gjn A: [70191]
Details for d1gjna_
PDB Entry: 1gjn (more details), 1.35 Å
PDB Description: hydrogen peroxide derived myoglobin compound ii at ph 5.2
SCOP Domain Sequences for d1gjna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gjna_ a.1.1.2 (A:) Myoglobin {Horse (Equus caballus)}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfqg
SCOP Domain Coordinates for d1gjna_:
Click to download the PDB-style file with coordinates for d1gjna_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gjna_:
- d1gjna_ is new in SCOP 1.61
- d1gjna_ appears in SCOP 1.63
- d1gjna_ appears in the current release, SCOPe 2.08
View in 3D