Lineage for d1gjib1 (1gji B:182-281)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2038571Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2038572Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins)
    subgroup of the larger IPT/TIG domain family
  6. 2038619Protein p65 subunit of NF-kappa B (NFKB), dimerization domain [49253] (3 species)
  7. 2038620Species Chicken (Gallus gallus), C-rel [TaxId:9031] [74848] (1 PDB entry)
  8. 2038622Domain d1gjib1: 1gji B:182-281 [70189]
    Other proteins in same PDB: d1gjia2, d1gjib2
    protein/DNA complex

Details for d1gjib1

PDB Entry: 1gji (more details), 2.85 Å

PDB Description: Crystal structure of c-Rel bound to DNA
PDB Compounds: (B:) c-rel proto-oncogene protein

SCOPe Domain Sequences for d1gjib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gjib1 b.1.18.1 (B:182-281) p65 subunit of NF-kappa B (NFKB), dimerization domain {Chicken (Gallus gallus), C-rel [TaxId: 9031]}
taelricrvnkncgsvkggdeifilcdkvqkddievrfvldnweakgsfsqadvhrqvai
vfrtppflrditepitvkmqlrrpsdqevsepmdfrylpd

SCOPe Domain Coordinates for d1gjib1:

Click to download the PDB-style file with coordinates for d1gjib1.
(The format of our PDB-style files is described here.)

Timeline for d1gjib1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gjib2