Lineage for d1gjia1 (1gji A:182-281)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2375023Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2375024Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins)
    subgroup of the larger IPT/TIG domain family
  6. 2375071Protein p65 subunit of NF-kappa B (NFKB), dimerization domain [49253] (3 species)
  7. 2375072Species Chicken (Gallus gallus), C-rel [TaxId:9031] [74848] (1 PDB entry)
  8. 2375073Domain d1gjia1: 1gji A:182-281 [70187]
    Other proteins in same PDB: d1gjia2, d1gjib2
    protein/DNA complex

Details for d1gjia1

PDB Entry: 1gji (more details), 2.85 Å

PDB Description: Crystal structure of c-Rel bound to DNA
PDB Compounds: (A:) c-rel proto-oncogene protein

SCOPe Domain Sequences for d1gjia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gjia1 b.1.18.1 (A:182-281) p65 subunit of NF-kappa B (NFKB), dimerization domain {Chicken (Gallus gallus), C-rel [TaxId: 9031]}
taelricrvnkncgsvkggdeifilcdkvqkddievrfvldnweakgsfsqadvhrqvai
vfrtppflrditepitvkmqlrrpsdqevsepmdfrylpd

SCOPe Domain Coordinates for d1gjia1:

Click to download the PDB-style file with coordinates for d1gjia1.
(The format of our PDB-style files is described here.)

Timeline for d1gjia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gjia2