SCOP 1.75: Domain d1gjd.1: 1gjd A:,B:

Lineage for d1gjd.1 (1gjd A:,B:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein Urokinase-type plasminogen activator (LMW U-PA), catalytic domain [50586] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50587] (49 PDB entries)
   Uniprot P00749 156-178,179-424

8. Domain d1gjd.1: 1gjd A:,B: [70186]
   complexed with 136, cit; mutant

Details for d1gjd.1

PDB Entry: 1gjd, 1.75 Å

PDB Description: engineering inhibitors highly selective for the s1 sites of ser190 trypsin-like serine protease drug targets

PDB Compounds: (A:) urokinase-type plasminogen activator, (B:) urokinase-type plasminogen activator

SCOP Domain Sequences for d1gjd.1:

Sequence; same for both SEQRES and ATOM records:

>g1gjd.1 b.47.1.2 (A:,B:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
ppeelkfqcgqktXiiggefttienqpwfaaiyrrhrggsvtyvcggslmspcwvisath
cfidypkkedyivylgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirsk
egrcaqpsrtiqticlpsmyndpqfgtsceitgfgkeastdylypeqlkmtvvklishre
cqqphyygsevttkmlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkd
kpgvytrvshflpwirsht

Timeline for d1gjd.1:

• d1gjd.1 first appeared in SCOP 1.61
  
• d1gjd.1 appears in SCOP 1.73
  
• d1gjd.1 appears in SCOPe 2.01
  
• d1gjd.1 appears in the current release, SCOPe 2.08