Lineage for d1gjb.1 (1gjb A:,B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064170Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2064171Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2064431Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2066053Protein Urokinase-type plasminogen activator (LMW U-PA), catalytic domain [50586] (1 species)
  7. 2066054Species Human (Homo sapiens) [TaxId:9606] [50587] (79 PDB entries)
    Uniprot P00749 156-178,179-424
  8. 2066098Domain d1gjb.1: 1gjb A:,B: [70184]
    complexed with 130, cit

Details for d1gjb.1

PDB Entry: 1gjb (more details), 1.9 Å

PDB Description: engineering inhibitors highly selective for the s1 sites of ser190 trypsin-like serine protease drug targets
PDB Compounds: (A:) urokinase-type plasminogen activator, (B:) urokinase-type plasminogen activator

SCOPe Domain Sequences for d1gjb.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1gjb.1 b.47.1.2 (A:,B:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
lkfqcgqkXiiggefttienqpwfaaiyrrhrggsvtyvcggslmspcwvisathcfidy
pkkedyivylgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrca
qpsrtiqticlpsmyndpqfgtsceitgfgkeastdylypeqlkmtvvklishrecqqph
yygsevttkmlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvy
trvshflpwirshtk

SCOPe Domain Coordinates for d1gjb.1:

Click to download the PDB-style file with coordinates for d1gjb.1.
(The format of our PDB-style files is described here.)

Timeline for d1gjb.1: