SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1gjb.1 (1gjb A:,B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055877Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2057409Protein Urokinase-type plasminogen activator (LMW U-PA), catalytic domain [50586] (1 species)
  7. 2057410Species Human (Homo sapiens) [TaxId:9606] [50587] (73 PDB entries)
    Uniprot P00749 156-178,179-424
  8. 2057454Domain d1gjb.1: 1gjb A:,B: [70184]
    complexed with 130, cit

Details for d1gjb.1

PDB Entry: 1gjb (more details), 1.9 Å

PDB Description: engineering inhibitors highly selective for the s1 sites of ser190 trypsin-like serine protease drug targets
PDB Compounds: (A:) urokinase-type plasminogen activator, (B:) urokinase-type plasminogen activator

SCOPe Domain Sequences for d1gjb.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1gjb.1 b.47.1.2 (A:,B:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
lkfqcgqkXiiggefttienqpwfaaiyrrhrggsvtyvcggslmspcwvisathcfidy
pkkedyivylgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrca
qpsrtiqticlpsmyndpqfgtsceitgfgkeastdylypeqlkmtvvklishrecqqph
yygsevttkmlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvy
trvshflpwirshtk

SCOPe Domain Coordinates for d1gjb.1:

Click to download the PDB-style file with coordinates for d1gjb.1.
(The format of our PDB-style files is described here.)

Timeline for d1gjb.1: