![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins) |
![]() | Protein Urokinase-type plasminogen activator (LMW U-PA), catalytic domain [50586] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50587] (49 PDB entries) Uniprot P00749 156-178,179-424 |
![]() | Domain d1gj9.1: 1gj9 A:,B: [70182] complexed with 134, cit; mutant |
PDB Entry: 1gj9 (more details), 1.8 Å
SCOP Domain Sequences for d1gj9.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1gj9.1 b.47.1.2 (A:,B:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} lkfqcgqktlXiiggefttienqpwfaaiyrrhrggsvtyvcggslmspcwvisathcfi dypkkedyivylgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegr caqpsrtiqticlpsmyndpqfgtsceitgfgkeastdylypeqlkmtvvklishrecqq phyygsevttkmlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpg vytrvshflpwirshtk
Timeline for d1gj9.1: