Lineage for d1gj9.1 (1gj9 A:,B:)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (38 proteins) 
Protein Urokinase-type plasminogen activator (LMW U-PA), catalytic domain [50586] (1 species) Species Human (Homo sapiens) [TaxId:9606] [50587] (19 PDB entries) 
Domain d1gj9.1: 1gj9 A:,B: [70182]
Details for d1gj9.1
PDB Entry: 1gj9 (more details), 1.8 Å
PDB Description: engineering inhibitors highly selective for the s1 sites of ser190 trypsin-like serine protease drug targets
SCOP Domain Sequences for d1gj9.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1gj9.1 b.47.1.2 (A:,B:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens)}
lkfqcgqktlXiiggefttienqpwfaaiyrrhrggsvtyvcggslmspcwvisathcfi
dypkkedyivylgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegr
caqpsrtiqticlpsmyndpqfgtsceitgfgkeastdylypeqlkmtvvklishrecqq
phyygsevttkmlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpg
vytrvshflpwirshtk
SCOP Domain Coordinates for d1gj9.1:
Click to download the PDB-style file with coordinates for d1gj9.1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gj9.1:
- d1gj9.1 is new in SCOP 1.61
- d1gj9.1 appears in SCOP 1.63
- d1gj9.1 appears in the current release, SCOPe 2.08
View in 3D