SCOPe 2.05: Domain d1gj6a_: 1gj6 A:

Lineage for d1gj6a_ (1gj6 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (396 PDB entries)
   Uniprot P00760

8. Domain d1gj6a_: 1gj6 A: [70179]
   complexed with 132, ca

Details for d1gj6a_

PDB Entry: 1gj6, 1.5 Å

PDB Description: engineering inhibitors highly selective for the s1 sites of ser190 trypsin-like serine protease drug targets

PDB Compounds: (A:) beta-trypsin

SCOPe Domain Sequences for d1gj6a_:

Sequence; same for both SEQRES and ATOM records:

>d1gj6a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d1gj6a_:

• d1gj6a_ first appeared in SCOP 1.61
  
• d1gj6a_ appears in SCOPe 2.04
  
• d1gj6a_ appears in SCOPe 2.06
  
• d1gj6a_ appears in the current release, SCOPe 2.08