Lineage for d1gc0b_ (1gc0 B:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 183637Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
  4. 183638Superfamily c.67.1: PLP-dependent transferases [53383] (6 families) (S)
  5. 183846Family c.67.1.3: Cystathionine synthase-like [53402] (7 protein domains)
  6. 183931Protein Methionine gamma-lyase, MGL [64126] (2 species)
  7. 183932Species Pseudomonas putida [TaxId:303] [75271] (2 PDB entries)
  8. 183934Domain d1gc0b_: 1gc0 B: [70169]

Details for d1gc0b_

PDB Entry: 1gc0 (more details), 1.7 Å

PDB Description: crystal structure of the pyridoxal-5'-phosphate dependent l-methionine gamma-lyase from pseudomonas putida

SCOP Domain Sequences for d1gc0b_:

Sequence, based on SEQRES records: (download)

>d1gc0b_ c.67.1.3 (B:) Methionine gamma-lyase, MGL {Pseudomonas putida}
lpgfatraihhgydpqdhggalvppvyqtatftfptveygaacfageqaghfysrisnpt
lnllearmasleggeaglalasgmgaitstlwtllrpgdevllgntlygctfaflhhgig
efgvklrhvdmadlqaleaamtpatrviyfespanpnmhmadiagvakiarkhgatvvvd
ntyctpylqrplelgadlvvhsatkylsghgditagivvgsqalvdrirlqglkdmtgav
lsphdaallmrgiktlnlrmdrhcanaqvlaeflarqpqvelihypglasfpqytlarqq
msqpggmiafelkggigagrrfmnalqlfsravslgdaeslaqhpasmthssytpeerah
ygiseglvrlsvglediddlladvqqalkasa

Sequence, based on observed residues (ATOM records): (download)

>d1gc0b_ c.67.1.3 (B:) Methionine gamma-lyase, MGL {Pseudomonas putida}
lpgfatraihhgydpqdhggalvppvyqtatftfptvesnptlnllearmasleggeagl
alasgmgaitstlwtllrpgdevllgntlygctfaflhhgigefgvklrhvdmadlqale
aamtpatrviyfespanpnmhmadiagvakiarkhgatvvvdntyctpylqrplelgadl
vvhsatkylsghgditagivvgsqalvdrirlqglkdmtgavlsphdaallmrgiktlnl
rmdrhcanaqvlaeflarqpqvelihyppggmiafelkggigagrrfmnalqlfsravsl
gdaeslaqhpasmthssytpeerahygiseglvrlsvglediddlladvqqalkasa

SCOP Domain Coordinates for d1gc0b_:

Click to download the PDB-style file with coordinates for d1gc0b_.
(The format of our PDB-style files is described here.)

Timeline for d1gc0b_: