Lineage for d1gc0a_ (1gc0 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2131439Family c.67.1.3: Cystathionine synthase-like [53402] (17 protein domains)
  6. 2131568Protein Methionine gamma-lyase, MGL [64126] (4 species)
  7. 2131579Species Pseudomonas putida [TaxId:303] [75271] (10 PDB entries)
    Uniprot P13254
  8. 2131580Domain d1gc0a_: 1gc0 A: [70168]

Details for d1gc0a_

PDB Entry: 1gc0 (more details), 1.7 Å

PDB Description: crystal structure of the pyridoxal-5'-phosphate dependent l-methionine gamma-lyase from pseudomonas putida
PDB Compounds: (A:) methionine gamma-lyase

SCOPe Domain Sequences for d1gc0a_:

Sequence, based on SEQRES records: (download)

>d1gc0a_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Pseudomonas putida [TaxId: 303]}
lpgfatraihhgydpqdhggalvppvyqtatftfptveygaacfageqaghfysrisnpt
lnllearmasleggeaglalasgmgaitstlwtllrpgdevllgntlygctfaflhhgig
efgvklrhvdmadlqaleaamtpatrviyfespanpnmhmadiagvakiarkhgatvvvd
ntyctpylqrplelgadlvvhsatkylsghgditagivvgsqalvdrirlqglkdmtgav
lsphdaallmrgiktlnlrmdrhcanaqvlaeflarqpqvelihypglasfpqytlarqq
msqpggmiafelkggigagrrfmnalqlfsravslgdaeslaqhpasmthssytpeerah
ygiseglvrlsvglediddlladvqqalkasa

Sequence, based on observed residues (ATOM records): (download)

>d1gc0a_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Pseudomonas putida [TaxId: 303]}
lpgfatraihhgydpqdhggalvppvyqtatftfpsnptlnllearmasleggeaglala
sgmgaitstlwtllrpgdevllgntlygctfaflhhgigefgvklrhvdmadlqaleaam
tpatrviyfespanpnmhmadiagvakiarkhgatvvvdntyctpylqrplelgadlvvh
satkylsghgditagivvgsqalvdrirlqglkdmtgavlsphdaallmrgiktlnlrmd
rhcanaqvlaeflarqpqvelihypqpggmiafelkggigagrrfmnalqlfsravslgd
aeslaqhpasmthssytpeerahygiseglvrlsvglediddlladvqqalkasa

SCOPe Domain Coordinates for d1gc0a_:

Click to download the PDB-style file with coordinates for d1gc0a_.
(The format of our PDB-style files is described here.)

Timeline for d1gc0a_: