Lineage for d1g9tb_ (1g9t B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2128255Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2128256Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2128257Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 protein domains)
  6. 2128315Protein Hypoxanthine PRTase [53286] (4 species)
  7. 2128316Species Escherichia coli [TaxId:562] [75255] (3 PDB entries)
  8. 2128320Domain d1g9tb_: 1g9t B: [70167]
    complexed with 5gp, n

Details for d1g9tb_

PDB Entry: 1g9t (more details), 2.8 Å

PDB Description: crystal structure of e.coli hprt-gmp complex
PDB Compounds: (B:) hypoxanthine phosphoribosyltransferase

SCOPe Domain Sequences for d1g9tb_:

Sequence, based on SEQRES records: (download)

>d1g9tb_ c.61.1.1 (B:) Hypoxanthine PRTase {Escherichia coli [TaxId: 562]}
mkhtvevmipeaeikariaelgrqiterykdsgsdmvlvgllrgsfmfmadlcrevqvsh
evdfmtassygsgmsttrdlkilkdldedirgkdvlivediidsgntlskvreilslrep
kslaictlldkpsrrevnvpvefigfsipdefvvgygidyaqryrhlpyigkvilld

Sequence, based on observed residues (ATOM records): (download)

>d1g9tb_ c.61.1.1 (B:) Hypoxanthine PRTase {Escherichia coli [TaxId: 562]}
mkhtvevmipeaeikariaelgrqiterykdsgsdmvlvgllrgsfmfmadlcrevqvsh
evdfmtassrdlkilkdldedirgkdvlivediidsgntlskvreilslrepkslaictl
ldkpsrrevnvpvefigfsipdefvvgygidyaqryrhlpyigkvilld

SCOPe Domain Coordinates for d1g9tb_:

Click to download the PDB-style file with coordinates for d1g9tb_.
(The format of our PDB-style files is described here.)

Timeline for d1g9tb_: