SCOPe 2.08: Domain d1g9sa_: 1g9s A:

Lineage for d1g9sa_ (1g9s A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein Hypoxanthine PRTase [53286] (4 species)

7. Species Escherichia coli [TaxId:562] [75255] (3 PDB entries)

8. Domain d1g9sa_: 1g9s A: [70164]
   complexed with imp, n

Details for d1g9sa_

PDB Entry: 1g9s, 2.8 Å

PDB Description: crystal structure of a complex between e.coli hprt and imp

PDB Compounds: (A:) hypoxanthine phosphoribosyltransferase

SCOPe Domain Sequences for d1g9sa_:

Sequence, based on SEQRES records:

>d1g9sa_ c.61.1.1 (A:) Hypoxanthine PRTase {Escherichia coli [TaxId: 562]}
mkhtvevmipeaeikariaelgrqiterykdsgsdmvlvgllrgsfmfmadlcrevqvsh
evdfmtassygsgmsttrdlkilkdldedirgkdvlivediidsgntlskvreilslrep
kslaictlldkpsrrevnvpvefigfsipdefvvgygidyaqryrhlpyigkvilld

Sequence, based on observed residues (ATOM records):

>d1g9sa_ c.61.1.1 (A:) Hypoxanthine PRTase {Escherichia coli [TaxId: 562]}
mkhtvevmipeaeikariaelgrqiterykdsgsdmvlvgllrgsfmfmadlcrevqvsh
evdfmtassrdlkilkdldedirgkdvlivediidsgntlskvreilslrepkslaictl
ldkpsrrevnvpvefigfsipdefvvgygidyaqryrhlpyigkvilld

Timeline for d1g9sa_:

• d1g9sa_ first appeared in SCOP 1.61
  
• d1g9sa_ appears in SCOPe 2.07