SCOP 1.69: Domain d1g9ha1: 1g9h A:355-448

Lineage for d1g9ha1 (1g9h A:355-448)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (3 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Bacterial alpha-Amylase [51013] (6 species)

7. Species Pseudoalteromonas haloplanctis (Alteromonas haloplanctis) [51015] (9 PDB entries)

8. Domain d1g9ha1: 1g9h A:355-448 [70162]
   Other proteins in same PDB: d1g9ha2

Details for d1g9ha1

PDB Entry: 1g9h, 1.8 Å

PDB Description: ternary complex between psychrophilic alpha-amylase, comii (pseudo tri-saccharide from bayer) and tris (2-amino-2-hydroxymethyl-propane- 1,3-diol)

SCOP Domain Sequences for d1g9ha1:

Sequence; same for both SEQRES and ATOM records:

>d1g9ha1 b.71.1.1 (A:355-448) Bacterial alpha-Amylase {Pseudoalteromonas haloplanctis (Alteromonas haloplanctis)}
nwavtnwwdntnnqisfgrgssghmainkedstltatvqtdmasgqycnvlkgelsadak
scsgevitvnsdgtinlnigawdamaihknakln

Timeline for d1g9ha1:

• d1g9ha1 first appeared in SCOP 1.61
  
• d1g9ha1 appears in SCOP 1.67
  
• d1g9ha1 appears in SCOP 1.71
  
• d1g9ha1 appears in the current release, SCOPe 2.08