Lineage for d1g86a_ (1g86 A:)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (14 families) 
Family b.29.1.3: Galectin (animal S-lectin) [49932] (4 proteins) 
Protein Charcot-Leyden crystal (CLC) protein [49938] (1 species) Species Human (Homo sapiens) [TaxId:9606] [49939] (4 PDB entries) 
Domain d1g86a_: 1g86 A: [70161]
Details for d1g86a_
PDB Entry: 1g86 (more details), 1.8 Å
PDB Description: charcot-leyden crystal protein/n-ethylmaleimide complex
SCOP Domain Sequences for d1g86a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g86a_ b.29.1.3 (A:) Charcot-Leyden crystal (CLC) protein {Human (Homo sapiens)}
sllpvpyteaaslstgstvtikgrplvcflnepylqvdfhtemkeesdivfhfqvcfgrr
vvmnsreygawkqqvesknmpfqdgqefelsisvlpdkyqvmvngqssytfdhrikpeav
kmvqvwrdisltkfnvsylkr
SCOP Domain Coordinates for d1g86a_:
Click to download the PDB-style file with coordinates for d1g86a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1g86a_:
- d1g86a_ is new in SCOP 1.61
- d1g86a_ appears in SCOP 1.63
- d1g86a_ appears in the current release, SCOPe 2.08
View in 3D