SCOP 1.61: Domain d1g85b_: 1g85 B:

Lineage for d1g85b_ (1g85 B:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)

4. Superfamily b.60.1: Lipocalins [50814] (3 families)

5. Family b.60.1.1: Retinol binding protein-like [50815] (16 proteins)

6. Protein Odorant-binding protein [50821] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50822] (4 PDB entries)

8. Domain d1g85b_: 1g85 B: [70160]

Details for d1g85b_

PDB Entry: 1g85, 1.8 Å

PDB Description: crystal structure of bovine odorant binding protein complexed with is natural ligand

SCOP Domain Sequences for d1g85b_:

Sequence; same for both SEQRES and ATOM records:

>d1g85b_ b.60.1.1 (B:) Odorant-binding protein {Cow (Bos taurus)}
eeeaeqnlselsgpwrtvyigstnpekiqengpfrtyfrelvfddekgtvdfyfsvkrdg
kwknvhvkatkqddgtyvadyegqnvfkivslsrthlvahninvdkhgqtteltglfvkl
nvededlekfwkltedkgidkknvvnflenenhph

Timeline for d1g85b_:

• d1g85b_ is new in SCOP 1.61
  
• d1g85b_ appears in SCOP 1.63
  
• d1g85b_ appears in the current release, SCOPe 2.08