Lineage for d1g85a_ (1g85 A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 169857Fold b.60: Lipocalins [50813] (1 superfamily)
  4. 169858Superfamily b.60.1: Lipocalins [50814] (3 families) (S)
  5. 169859Family b.60.1.1: Retinol binding protein-like [50815] (16 proteins)
  6. 169964Protein Odorant-binding protein [50821] (2 species)
  7. 169965Species Cow (Bos taurus) [TaxId:9913] [50822] (4 PDB entries)
  8. 169966Domain d1g85a_: 1g85 A: [70159]

Details for d1g85a_

PDB Entry: 1g85 (more details), 1.8 Å

PDB Description: crystal structure of bovine odorant binding protein complexed with is natural ligand

SCOP Domain Sequences for d1g85a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g85a_ b.60.1.1 (A:) Odorant-binding protein {Cow (Bos taurus)}
aqeeeaeqnlselsgpwrtvyigstnpekiqengpfrtyfrelvfddekgtvdfyfsvkr
dgkwknvhvkatkqddgtyvadyegqnvfkivslsrthlvahninvdkhgqtteltglfv
klnvededlekfwkltedkgidkknvvnflenenhphpe

SCOP Domain Coordinates for d1g85a_:

Click to download the PDB-style file with coordinates for d1g85a_.
(The format of our PDB-style files is described here.)

Timeline for d1g85a_: