Lineage for d1g7qa2 (1g7q A:1-181)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 255210Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 255211Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 255212Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)
  6. 255238Protein MHC class I, alpha-1 and alpha-2 domains [54468] (19 species)
  7. 255359Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (23 PDB entries)
  8. 255364Domain d1g7qa2: 1g7q A:1-181 [70157]
    Other proteins in same PDB: d1g7qa1, d1g7qb_
    complexed with fuc, nag

Details for d1g7qa2

PDB Entry: 1g7q (more details), 1.6 Å

PDB Description: crystal structure of mhc class i h-2kb heavy chain complexed with beta-2 microglobulin and muc1 vntr peptide sapdtrpa

SCOP Domain Sequences for d1g7qa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g7qa2 d.19.1.1 (A:1-181) MHC class I, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB}
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r

SCOP Domain Coordinates for d1g7qa2:

Click to download the PDB-style file with coordinates for d1g7qa2.
(The format of our PDB-style files is described here.)

Timeline for d1g7qa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1g7qa1
View in 3D
Domains from other chains:
(mouse over for more information)
d1g7qb_