Lineage for d1g60b_ (1g60 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2129507Family c.66.1.11: Type II DNA methylase [53377] (3 protein domains)
    circularly permuted version of the common fold
  6. 2129518Protein Methyltransferase mboII [75267] (1 species)
  7. 2129519Species Moraxella bovis [TaxId:476] [75268] (1 PDB entry)
  8. 2129521Domain d1g60b_: 1g60 B: [70152]
    complexed with na, sam

Details for d1g60b_

PDB Entry: 1g60 (more details), 1.74 Å

PDB Description: Crystal Structure of Methyltransferase MboIIa (Moraxella bovis)
PDB Compounds: (B:) Adenine-specific Methyltransferase MboIIA

SCOPe Domain Sequences for d1g60b_:

Sequence, based on SEQRES records: (download)

>d1g60b_ c.66.1.11 (B:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]}
mleinkihqmncfdfldqvenksvqlavidppynlskadwdsfdshneflaftyrwidkv
ldkldkdgslyifntpfncaficqylvskgmifqnwitwdkrdgmgsakrrfstgqetil
ffsksknhtfnydevrvpyestdrikhasekgilkngkrwfpnpngrlcgevwhfssqrh
kekvngktvklthitpkprdlieriirassnpndlvldcfmgsgttaivakklgrnfigc
dmnaeyvnqanfvlnq

Sequence, based on observed residues (ATOM records): (download)

>d1g60b_ c.66.1.11 (B:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]}
mleinkihqmncfdfldqvenksvqlavidppynlskadwdsfdshneflaftyrwidkv
ldkldkdgslyifntpfncaficqylvskgmifqnwitwdkrdgmgsakrrfstgqetil
ffsksknhtfnydevrvpygilkngkrwfpnpngrlcgevwhfssitpkprdlieriira
ssnpndlvldcfmgsgttaivakklgrnfigcdmnaeyvnqanfvlnq

SCOPe Domain Coordinates for d1g60b_:

Click to download the PDB-style file with coordinates for d1g60b_.
(The format of our PDB-style files is described here.)

Timeline for d1g60b_: