Lineage for d1g2ta_ (1g2t A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 188772Fold d.9: IL8-like [54116] (2 superfamilies)
  4. 188773Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) (S)
  5. 188774Family d.9.1.1: Interleukin 8-like chemokines [54118] (22 proteins)
  6. 188799Protein Eotaxin-3 [75341] (1 species)
  7. 188800Species Human (Homo sapiens) [TaxId:9606] [75342] (2 PDB entries)
  8. 188801Domain d1g2ta_: 1g2t A: [70150]

Details for d1g2ta_

PDB Entry: 1g2t (more details)

PDB Description: solution structure of eotaxin-3

SCOP Domain Sequences for d1g2ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g2ta_ d.9.1.1 (A:) Eotaxin-3 {Human (Homo sapiens)}
trgsdisktccfqyshkplpwtwvrsyeftsnscsqravifttkrgkkvcthprkkwvqk
yisllktpkql

SCOP Domain Coordinates for d1g2ta_:

Click to download the PDB-style file with coordinates for d1g2ta_.
(The format of our PDB-style files is described here.)

Timeline for d1g2ta_: