Lineage for d1g2ta_ (1g2t A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2499233Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2499234Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2499235Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 protein domains)
  6. 2499257Protein Eotaxin-3 [75341] (1 species)
  7. 2499258Species Human (Homo sapiens) [TaxId:9606] [75342] (2 PDB entries)
  8. 2499260Domain d1g2ta_: 1g2t A: [70150]

Details for d1g2ta_

PDB Entry: 1g2t (more details)

PDB Description: solution structure of eotaxin-3
PDB Compounds: (A:) eotaxin-3

SCOPe Domain Sequences for d1g2ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g2ta_ d.9.1.1 (A:) Eotaxin-3 {Human (Homo sapiens) [TaxId: 9606]}
trgsdisktccfqyshkplpwtwvrsyeftsnscsqravifttkrgkkvcthprkkwvqk
yisllktpkql

SCOPe Domain Coordinates for d1g2ta_:

Click to download the PDB-style file with coordinates for d1g2ta_.
(The format of our PDB-style files is described here.)

Timeline for d1g2ta_: