| Class a: All alpha proteins [46456] (202 folds) |
| Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) ![]() |
| Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins) |
| Protein Snake phospholipase A2 [48624] (33 species) |
| Species Snake (Daboia russelli pulchella) [48630] (15 PDB entries) |
| Domain d1fv0a_: 1fv0 A: [70147] |
PDB Entry: 1fv0 (more details), 1.7 Å
SCOP Domain Sequences for d1fv0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fv0a_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Daboia russelli pulchella)}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c
Timeline for d1fv0a_: