SCOP 1.67: Domain d1fv0a_: 1fv0 A:

Lineage for d1fv0a_ (1fv0 A:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)

6. Protein Snake phospholipase A2 [48624] (33 species)

7. Species Snake (Daboia russelli pulchella) [48630] (15 PDB entries)

8. Domain d1fv0a_: 1fv0 A: [70147]

Details for d1fv0a_

PDB Entry: 1fv0, 1.7 Å

PDB Description: first structural evidence of the inhibition of phospholipase a2 by aristolochic acid: crystal structure of a complex formed between phospholipase a2 and aristolochic acid

SCOP Domain Sequences for d1fv0a_:

Sequence; same for both SEQRES and ATOM records:

>d1fv0a_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Daboia russelli pulchella)}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

Timeline for d1fv0a_:

• d1fv0a_ first appeared in SCOP 1.61
  
• d1fv0a_ appears in SCOP 1.65
  
• d1fv0a_ appears in SCOP 1.69
  
• d1fv0a_ appears in the current release, SCOPe 2.08