Lineage for d1fnoa3 (1fno A:208-320)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.19: Bacterial exopeptidase dimerisation domain [55031] (1 family) 
Family d.58.19.1: Bacterial exopeptidase dimerisation domain [55032] (8 proteins) 
Protein Peptidase T (tripeptidase) [75443] (2 species) Species Salmonella typhimurium [TaxId:90371] [75444] (1 PDB entry) 
Domain d1fnoa3: 1fno A:208-320 [70145]
Other proteins in same PDB: d1fnoa4
complexed with so4, zn
Details for d1fnoa3
PDB Entry: 1fno (more details), 2.4 Å
PDB Description: peptidase t (tripeptidase)
PDB Compounds: (A:) Peptidase TSCOPe Domain Sequences for d1fnoa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fnoa3 d.58.19.1 (A:208-320) Peptidase T (tripeptidase) {Salmonella typhimurium [TaxId: 90371]}
fnaasvnikivgnnvhpgtakgvmvnalslaarihaevpadeapettegyegfyhlasmk
gtvdraemhyiirdfdrkqfearkrkmmeiakkvgkglhpdcyielviedsyy
SCOPe Domain Coordinates for d1fnoa3:
Click to download the PDB-style file with coordinates for d1fnoa3.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fnoa3:
- d1fnoa3 first appeared in SCOP 1.61
- d1fnoa3 appears in SCOPe 2.07
View in 3D
